PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G0630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 258aa    MW: 29920.2 Da    PI: 4.9288
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G0630genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l  +++++G  +W+  +++ g++R++k+c++rw +yl
      Gh_D13G0630 14 KGEWSAEEDHKLRSYIQRYGHWNWRELPKYAGLKRCGKSCRLRWMNYL 61
                     799*****************99************************97 PP

2Myb_DNA-binding53.94.3e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEd l+++++ ++G++ W+tIa+ ++ gRt++++k+ w+ +
      Gh_D13G0630  67 RGNFTEEEDALIIKLHDEMGNR-WSTIAKSFP-GRTDNEIKNQWHAH 111
                      89********************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.818961IPR017930Myb domain
SuperFamilySSF466892.43E-3011108IPR009057Homeodomain-like
SMARTSM007171.4E-101363IPR001005SANT/Myb domain
PfamPF002498.7E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-231568IPR009057Homeodomain-like
CDDcd001674.89E-81661No hitNo description
PROSITE profilePS5129425.97462116IPR017930Myb domain
SMARTSM007173.8E-1766114IPR001005SANT/Myb domain
PfamPF002492.6E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2669115IPR009057Homeodomain-like
CDDcd001674.36E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MVRAPFYDKN GMKKGEWSAE EDHKLRSYIQ RYGHWNWREL PKYAGLKRCG KSCRLRWMNY  60
LRPELKRGNF TEEEDALIIK LHDEMGNRWS TIAKSFPGRT DNEIKNQWHA HLKKRTKRDE  120
KEKSDCWQSE ATRNENICEG EGEGEDESNS ILVDTLDNMI LESSPLSPAT CTRIEQSSFS  180
SGRGPTFSFN VVGGLEDNCL PCLGTYKNEG SGDFWSEPFV ADNTSSLEKG GFEMLLEYED  240
MYHDDSAYLL YEFTQGWI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461816.10.0PREDICTED: transcription factor MYB82-like
SwissprotP200241e-52MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0D2VBU50.0A0A0D2VBU5_G
STRINGPOPTR_0019s14130.11e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3716322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.13e-54myb domain protein 14